PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008223286.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family ARR-B
Protein Properties Length: 676aa    MW: 73965.9 Da    PI: 6.2097
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008223286.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.51.4e-28213266155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  XP_008223286.1 213 KPRVVWSVELHQQFVGAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 266
                     79*******************.********************************8 PP

2Response_reg75.32.4e-25351431109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl+vdD+p+ +++l+++l+   y ev+ +  +e al+ll+e++  +D+++ D+ mp+mdG++ll++   e  +lp+i+++a + ++ + + +  G
  XP_008223286.1  35 VLVVDDDPTCLMILEKMLRTCLY-EVTKCNRAEIALNLLRENKngYDIVISDVHMPDMDGFKLLERVGLEM-DLPVIMMSADDGKSVVMKGVTHG 127
                     89*********************.***************999999**********************6644.8********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +e+l +
  XP_008223286.1 128 ACDYLIKPVRIEALKN 143
                     ************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.4E-1839668IPR017053Response regulator B-type, plant
SuperFamilySSF521721.14E-3432157IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23006.0E-4232173No hitNo description
SMARTSM004483.2E-3033145IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.54134149IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-2235143IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.31E-2736148No hitNo description
PROSITE profilePS512949.894210269IPR017930Myb domain
SuperFamilySSF466898.96E-20210270IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-30212271IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-24213266IPR006447Myb domain, plants
PfamPF002495.5E-7215265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MNLSNGMGSM STASSSGAWK SADVVSDQFP AGLRVLVVDD DPTCLMILEK MLRTCLYEVT  60
KCNRAEIALN LLRENKNGYD IVISDVHMPD MDGFKLLERV GLEMDLPVIM MSADDGKSVV  120
MKGVTHGACD YLIKPVRIEA LKNIWQHVVR KKKNEWKEVE QSGSVEEGDR QPKPSEDADY  180
SSSANEGTWK NSKRRKDEEE EADERDDSST LKKPRVVWSV ELHQQFVGAV NQLGIDKAVP  240
KKILELMNVP GLTRENVASH LQKYRLYLRR LSGVSQHPSN LNNSFLSPQE ASFGAMSSLN  300
GLDLQTLAVT GQLPAQSLAT LQAGLGRSTA KSGMPMPLVD QRNLFSFENP KLRFAEGQQH  360
LSSSKPMNLL HGIPTNMEAK QLANLHQSAQ SLGGVNMQVN AHGVQNSALL MQMSQPQSRG  420
QILNETSGNH VPRLSSSMGQ PILSNGIPSG VLGRNGIADN GRGAGYNPVQ QNSSMLNFPL  480
NNSSELPGNN FTLGSTPGMS SLTSKGAFPE DVNCEIKRSS GFAPSYDIFN ELHQHKSNDW  540
DLQNVGLTFD ASQHTNTMHG SLDSSVLVHQ GFSSSQRSVQ SRNPSTVGKA MFSIGEGTHH  600
VNVQNNGQHL NSLIVDNTVR VKAERVPDAS SQTSYFNEQF GQEDLMSALL KQQQEGIGAT  660
ENEFDFDGYS LDNIPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-21212272464ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008223286.10.0PREDICTED: two-component response regulator ARR2 isoform X1
SwissprotQ940D00.0ARR1_ARATH; Two-component response regulator ARR1
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLM5XK840.0M5XK84_PRUPE; Uncharacterized protein
STRINGGLYMA07G37220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.20.0response regulator 1